PNC-27 (5mg) – Product Description
PNC-27 (5mg) is a synthetic peptide supplied exclusively for controlled laboratory research,
analytical testing, and in-vitro experimentation. It is intended for use by qualified
researchers working in appropriately equipped facilities.
PNC-27 is a 32-residue chimeric peptide containing a p53-derived sequence connected to a
membrane-residency sequence. Laboratory investigations may examine peptide–protein association,
membrane localization, HDM-2-related binding behavior, and membrane structure within defined
experimental systems.
Lot-specific analytical documentation is available for material identification and laboratory
recordkeeping. Researchers should consult the applicable Certificate of Analysis for reported
purity, identity, and testing information.
For laboratory research use only. Not for human or animal consumption. Not for diagnostic,
therapeutic, veterinary, food, cosmetic, or dietary-supplement use.
PNC-27 (5mg) – Research Specifications:
| Product Name |
PNC-27 |
| Content |
5mg |
| Molecular Formula |
C188H293N53O44S |
| Molecular Weight |
Approximately 4032 g/mol |
| CAS Number |
1159861-00-3 |
| PubChem CID |
16201774 |
| Amino Acid Sequence |
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG |
| Sequence Length |
32 amino-acid residues |
| Source |
Synthetic |
| Format |
Lyophilized powder |
| Purity and Identity |
Refer to the lot-specific Certificate of Analysis |
| Testing Documentation |
Lot-specific analytical documentation is available |
| Storage Conditions |
Store sealed in a dry, temperature-controlled environment protected from direct light,
moisture, and repeated temperature fluctuations. Follow the product label and lot-specific
documentation.
|
| Research Use Only |
Supplied exclusively for laboratory research. Not for human or animal consumption or
in-vivo procedures.
|
What Is PNC-27? Research Background and Mechanistic Context
PNC-27 is a laboratory-synthesized chimeric peptide composed of two sequence regions. The first
corresponds to residues 12–26 of p53, while the second is a membrane-residency sequence.
Published in-vitro research has examined PNC-27 in connection with HDM-2-associated membrane
models. These investigations have evaluated peptide localization, peptide–protein association,
membrane organization, and pore-structure observations in defined cell-culture systems.
These findings represent experimental observations obtained under specific laboratory
conditions. They do not establish clinical utility, human outcomes, or an approved medical
application.
Research involving PNC-27 should incorporate defined controls, validated analytical methods,
documented cell-line characteristics, and reproducible assay conditions. Variables such as
sample concentration, exposure period, temperature, culture environment, analytical platform,
and baseline HDM-2 expression can affect experimental observations.
Important Research Notice: Nordsci Peptides provides lot-specific analytical
documentation for laboratory recordkeeping and material verification.
THIS PRODUCT IS INTENDED EXCLUSIVELY FOR LABORATORY RESEARCH USE. NOT FOR HUMAN OR ANIMAL
CONSUMPTION. NOT FOR CLINICAL, DIAGNOSTIC, THERAPEUTIC, VETERINARY, FOOD, COSMETIC, OR
SUPPLEMENT APPLICATIONS.
PNC-27 – Key Research Applications
1. Cellular Membrane Interaction Studies
PNC-27 may be incorporated into controlled in-vitro assays examining peptide localization and
interaction with cellular membrane structures.
Researchers may evaluate membrane-associated fluorescence, permeability markers, structural
observations, or related analytical endpoints. Experimental conclusions should remain limited
to the tested model, assay design, and laboratory conditions.
2. Tumor-Associated Biomarker Pathway Research
Laboratory studies may examine PNC-27 in cell-line systems selected according to
membrane-associated HDM-2 expression.
Comparative experiments can include HDM-2-characterized cell lines, negative controls,
reference materials, and predefined analytical endpoints. Results from these models should not
be interpreted as evidence of clinical performance or suitability for human use.
3. Peptide–Receptor Binding Models
PNC-27 may be evaluated through controlled binding, localization, or colocalization assays
involving HDM-2 and related membrane-associated structures.
Applicable laboratory methods may include fluorescence microscopy, immunolabeling, flow
cytometry, biochemical binding assays, or other validated analytical techniques. Method
selection and interpretation remain the responsibility of qualified research personnel.
4. Comparative Cellular Response Frameworks
Research programs may compare PNC-27 with vehicle controls, sequence controls, reference
peptides, or untreated experimental groups.
Researchers should document cell-line identity, material lot number, assay timing,
environmental conditions, instrumentation, and analytical thresholds. Separating these
variables provides a clearer basis for evaluating whether an observation is associated with
the experimental material or another component of the study design.
Handling and Research Use Considerations
PNC-27 should be handled only by qualified laboratory personnel using institutional procedures
for synthetic research peptides. Laboratory records should document the material’s identity,
handling history, and experimental conditions.
- Product and lot identification
- Certificate of Analysis verification
- Receipt and storage dates
- Storage temperature and temperature-excursion history
- Experimental concentration and assay conditions
- Control materials and analytical methods
- Instrumentation and disposal documentation
Avoid contamination, unnecessary moisture exposure, repeated temperature cycling, and
uncontrolled environmental conditions. Material showing unexpected discoloration, compromised
packaging, or an undocumented storage excursion should be evaluated according to the
laboratory’s material-control procedures.
No preparation, administration, clinical application, or in-vivo instructions are provided.
Researchers are responsible for complying with applicable laws, regulations, institutional
policies, and laboratory protocols.
PNC-27 – Certificate of Analysis (COA)
Lot-specific Certificates of Analysis provide documentation related to the identity and
analytical characteristics of PNC-27. Depending on the testing completed for the applicable
lot, documentation may include the following:
- Product identity
- Lot or batch number
- Reported purity
- HPLC data
- Mass-spectrometry data
- Appearance
- Testing date and laboratory information
- Storage instructions
Researchers should review the applicable COA before incorporating the material into an
experimental workflow. Results reported for one lot should not be attributed to another lot
without reviewing the corresponding documentation.
Where to Buy PNC-27 (5mg) for Research Purposes
Nordsci Peptides supplies PNC-27 (5mg) exclusively as a laboratory research material.
Qualified purchasers should verify product identity, lot-specific documentation,
institutional requirements, and applicable regulations before ordering.
Purchase or possession does not authorize human use, animal use, clinical use, or any other
prohibited application.
IMPORTANT: PNC-27 is not a drug, dietary supplement, food, cosmetic, or
veterinary product. It is not intended for human or animal consumption or for diagnostic or
therapeutic procedures.
Scientific References
-
PubChem. PNC-27 Compound Summary, CID 16201774.
View reference
-
Sarafraz-Yazdi E, et al. Proceedings of the National Academy of Sciences. 2010;107(5):1918–1923.
PMID: 20080680. DOI: 10.1073/pnas.0909364107.
View reference
-
Pincus MR, et al. Published laboratory research concerning PNC-27, HDM-2 association,
and membrane-pore observations. PMID: 35625682.
View reference