LL-37 (5mg) is a synthetic, research-grade preparation of the 37-amino-acid human cathelicidin peptide LL-37. It is supplied as a lyophilized powder exclusively for controlled in vitro laboratory research, analytical testing, and peptide-characterization studies.
All products are produced using lyophilization (freeze-drying), a preservation method that allows peptides to remain fully stable during shipping for approximately 3-4 months. Once a peptide has been reconstituted with bacteriostatic water, it must be refrigerated to maintain integrity. After reconstitution, peptides typically remain stable for up to 30 days when stored properly.
Lyophilization, also referred to as cryodesiccation, is a specialized dehydration process in which peptides are first frozen and then exposed to a low-pressure environment. This causes the water within the vial to transition directly from a solid to a vapor (sublimation), leaving behind a dry, crystalline white material known as a lyophilized peptide. In this powdered form, peptides may be safely stored at room temperature until they are ready to be reconstituted with bacteriostatic water.
After delivery, peptides should be protected from heat and light. If use is expected within the near future (whether days, weeks, or a few months) refrigerated storage below 4°C (39°F) is generally sufficient. Lyophilized peptides are commonly stable at room temperature for several weeks or longer, making short-term ambient storage acceptable when use is anticipated within that timeframe.
For extended storage, ranging from several months to multiple years, freezing is strongly recommended. Storage at -80°C (-112°F) offers optimal long-term stability and helps preserve peptide structure and quality over time.
For more detailed guidance on peptide handling and storage best practices, please refer to the resource below:
LL-37 (5mg) is a synthetic, research-grade preparation of the 37-amino-acid human cathelicidin peptide LL-37. It is supplied as a lyophilized powder exclusively for controlled in vitro laboratory research, analytical testing, and peptide-characterization studies.
LL-37 is commonly classified in scientific literature as a cationic cathelicidin peptide. Its amino-acid sequence, charge distribution, amphipathic properties, precursor processing, and interactions with defined model membranes make it relevant to biochemical, biophysical, and cell-based laboratory research.
This material is not a drug, dietary supplement, food, cosmetic, or medical device. It is not intended for human or animal consumption, in vivo procedures, clinical investigation, diagnostic use, therapeutic application, or veterinary use.
LL-37 (5mg) – Research Specifications:
| Compound | LL-37 |
| Full Name | Human Cathelicidin Antimicrobial Peptide LL-37 |
| Quantity | 5mg per vial |
| Sequence | [LL-37, 37 aa] |
| Sequence Length | 37 amino acids |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | Approximately 4,493.3 g/mol |
| CAS Number | 154947-66-7 |
| Form | Lyophilized peptide powder |
| Purity / Identity | Refer to the lot-specific Certificate of Analysis for analytical results |
| Analytical Documentation | Batch-specific documentation may include HPLC and mass-spectrometry data |
| Storage Conditions | Store sealed, dry, and protected from heat, light, moisture, and repeated temperature changes |
| Research Classification | For controlled in vitro laboratory research and analytical use only |
| Restrictions | Not for human or animal consumption, in vivo procedures, or diagnostic or therapeutic use |
LL-37 is a 37-amino-acid peptide generated through proteolytic processing of the human cathelicidin precursor protein hCAP18. The peptide is identified by an N-terminal pair of leucine residues and has a positively charged, amphipathic amino-acid sequence.
Controlled laboratory studies examine LL-37 through techniques such as chromatography, mass spectrometry, spectroscopy, membrane-model assays, peptide-binding measurements, receptor-associated testing, and defined cell-culture experiments.
LL-37 research may also include the evaluation of peptide conformation, aggregation behavior, lipid binding, precursor processing, and molecular interactions within defined experimental systems. Results may vary according to concentration, pH, ionic strength, membrane composition, temperature, incubation period, and sample-handling conditions.
Important Research Notice: Nordsci research materials are accompanied by lot-specific analytical documentation. Laboratories should review the applicable Certificate of Analysis for compound identity, purity, testing methods, and batch information before beginning an experiment.
THIS PRODUCT IS INTENDED EXCLUSIVELY FOR IN VITRO LABORATORY RESEARCH. NOT FOR HUMAN OR ANIMAL CONSUMPTION. NOT FOR IN VIVO, DIAGNOSTIC, THERAPEUTIC, VETERINARY, FOOD, COSMETIC, OR SUPPLEMENT USE.
LL-37 may be examined in controlled laboratory systems involving cathelicidin expression, hCAP18 processing, peptide localization, receptor-associated measurements, and molecular signaling assays. These experiments are limited to research characterization and do not establish clinical utility.
In vitro studies may evaluate the physicochemical interaction of LL-37 with model membranes, defined microbial preparations, lipid systems, or other analytical substrates. Experimental endpoints may include peptide binding, membrane association, structural conformation, and concentration-dependent assay measurements.
Defined cell-based and biochemical assays may be used to examine LL-37 in relation to receptor activity, intracellular signaling markers, or cytokine-associated measurements. Findings depend on the selected model, controls, concentration range, and laboratory conditions and must not be interpreted as evidence of diagnostic or therapeutic performance.
Laboratory models may examine LL-37 expression, localization, peptide-membrane interactions, and molecular behavior in epithelial cell systems. This work is intended exclusively for mechanistic and analytical investigation.
LL-37 (5mg) should be handled by qualified laboratory personnel using established procedures for research peptides. Appropriate personal protective equipment, calibrated instruments, controlled storage, contamination prevention, and complete experimental documentation should be incorporated into the laboratory workflow.
Protocol Design Considerations: Experimental results may vary according to peptide concentration, solvent system, pH, ionic strength, temperature, incubation period, model selection, and analytical platform. Researchers should document these variables and include appropriate positive, negative, vehicle, and untreated controls where applicable.
No dosing, injection, administration, application, or human-use instructions are provided with this research material.
Note: This information is provided exclusively for laboratory identification, analytical planning, and research documentation. All work must be performed by qualified personnel in an appropriately controlled laboratory environment.
Each available lot of LL-37 supplied by Nordsci Peptides is associated with batch-specific analytical documentation. The Certificate of Analysis contains information relevant to compound identity, analytical purity, testing methods, lot traceability, and quality-control review.
Researchers should review the COA associated with the specific vial or lot rather than relying exclusively on generalized product specifications. Where listed, analytical methods may include high-performance liquid chromatography and mass spectrometry.
Nordsci Peptides supplies LL-37 (5mg) as a research-grade, lyophilized peptide for qualified laboratory and analytical use. Lot-specific documentation is available for laboratories evaluating material identity, purity, traceability, and suitability for a planned in vitro research method.
IMPORTANT: LL-37 (5mg) is sold exclusively for in vitro laboratory research. It is not approved for human or animal consumption and must not be used in diagnostic, therapeutic, veterinary, food, cosmetic, supplement, or other in vivo applications. The purchaser is responsible for compliance with all applicable laws, regulations, institutional policies, and laboratory-safety requirements.
